| Class b: All beta proteins [48724] (178 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (49 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries) |
| Domain d3czjc1: 3czj C:13-219 [245587] Other proteins in same PDB: d3czja2, d3czja3, d3czja4, d3czja5, d3czjb2, d3czjb3, d3czjb4, d3czjb5, d3czjc2, d3czjc3, d3czjc4, d3czjc5, d3czjd2, d3czjd3, d3czjd4, d3czjd5 automated match to d1f49a3 complexed with 149, dms, mg, na |
PDB Entry: 3czj (more details), 2.05 Å
SCOPe Domain Sequences for d3czjc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3czjc1 b.18.1.0 (C:13-219) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3czjc1:
View in 3DDomains from same chain: (mouse over for more information) d3czjc2, d3czjc3, d3czjc4, d3czjc5 |