Lineage for d1br2a1 (1br2 A:34-79)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783669Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) (S)
  5. 2783670Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 2783671Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
  7. 2783685Species Chicken (Gallus gallus), pectoral muscle [TaxId:9031] [50087] (4 PDB entries)
  8. 2783686Domain d1br2a1: 1br2 A:34-79 [24558]
    Other proteins in same PDB: d1br2a2, d1br2b2, d1br2c2, d1br2d2, d1br2e2, d1br2f2
    complexed with adp, alf, mg

Details for d1br2a1

PDB Entry: 1br2 (more details), 2.9 Å

PDB Description: smooth muscle myosin motor domain complexed with mgadp.alf4
PDB Compounds: (A:) myosin

SCOPe Domain Sequences for d1br2a1:

Sequence, based on SEQRES records: (download)

>d1br2a1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}
lvwvpsekhgfeaasikeekgdevtvelqengkkvtlskddiqkmn

Sequence, based on observed residues (ATOM records): (download)

>d1br2a1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}
lvwvpsekhgfeaasievtvelqengkkvtlskddiqkmn

SCOPe Domain Coordinates for d1br2a1:

Click to download the PDB-style file with coordinates for d1br2a1.
(The format of our PDB-style files is described here.)

Timeline for d1br2a1: