![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
![]() | Protein automated matches [254633] (16 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
![]() | Domain d3czja2: 3czj A:220-333 [245578] Other proteins in same PDB: d3czja1, d3czja3, d3czja5, d3czjb1, d3czjb3, d3czjb5, d3czjc1, d3czjc3, d3czjc5, d3czjd1, d3czjd3, d3czjd5 automated match to d1jz8a1 complexed with 149, dms, mg, na |
PDB Entry: 3czj (more details), 2.05 Å
SCOPe Domain Sequences for d3czja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3czja2 b.1.4.0 (A:220-333) automated matches {Escherichia coli K-12 [TaxId: 83333]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d3czja2:
![]() Domains from same chain: (mouse over for more information) d3czja1, d3czja3, d3czja4, d3czja5 |