Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (42 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225745] (21 PDB entries) |
Domain d3cxqa_: 3cxq A: [245574] automated match to d2huza_ complexed with glp |
PDB Entry: 3cxq (more details), 2.3 Å
SCOPe Domain Sequences for d3cxqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cxqa_ d.108.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kpdetpmfdpsllkevdwsqntatfspaispthpgeglvlrplctadlnrgffkvlgqlt etgvvspeqfmksfehmkksgdyyvtvvedvtlgqivatatliiehkfihscakrgrved vvvsdecrgkqlgklllstltllskklncykitleclpqnvgfykkfgytvseenymcrr fl
Timeline for d3cxqa_: