Lineage for d2mysa1 (2mys A:34-79)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13205Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 13206Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 13207Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)
  7. 13213Species Chicken (Gallus gallus), pectoral muscle [TaxId:9031] [50087] (4 PDB entries)
  8. 13214Domain d2mysa1: 2mys A:34-79 [24557]
    Other proteins in same PDB: d2mysa2, d2mysb_, d2mysc_

Details for d2mysa1

PDB Entry: 2mys (more details), 2.8 Å

PDB Description: myosin subfragment-1, alpha carbon coordinates only for the two light chains

SCOP Domain Sequences for d2mysa1:

Sequence, based on SEQRES records: (download)

>d2mysa1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle}
axssvfvvhpkqsfvxgtiqsxeggxvtvxteggetltvkedqvfs

Sequence, based on observed residues (ATOM records): (download)

>d2mysa1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle}
assvfvvhpkqsfvgtiqseggvtvteggetltvkedqvfs

SCOP Domain Coordinates for d2mysa1:

Click to download the PDB-style file with coordinates for d2mysa1.
(The format of our PDB-style files is described here.)

Timeline for d2mysa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mysa2