Lineage for d3cvva2 (3cvv A:216-505)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721241Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 2721242Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families) (S)
    automatically mapped to Pfam PF03441
  5. 2721307Family a.99.1.0: automated matches [231382] (1 protein)
    not a true family
  6. 2721308Protein automated matches [231383] (3 species)
    not a true protein
  7. 2721312Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231384] (8 PDB entries)
  8. 2721315Domain d3cvva2: 3cvv A:216-505 [245567]
    Other proteins in same PDB: d3cvva1, d3cvva3
    automated match to d2wb2a2
    protein/DNA complex; complexed with edo, fad, fo1

Details for d3cvva2

PDB Entry: 3cvv (more details), 2.1 Å

PDB Description: drosophila melanogaster (6-4) photolyase bound to ds dna with a t-t (6-4) photolesion and f0 cofactor
PDB Compounds: (A:) RE11660p

SCOPe Domain Sequences for d3cvva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cvva2 a.99.1.0 (A:216-505) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gpnkfpggetealrrmeeslkdeiwvarfekpntapnslepsttvlspylkfgclsarlf
nqklkeiikrqpkhsqppvsligqlmwrefyytvaaaepnfdrmlgnvycmqipwqehpd
hleawthgrtgypfidaimrqlrqegwihhlarhavacfltrgdlwisweegqrvfeqll
ldqdwalnagnwmwlsasaffhqyfrvyspvafgkktdpqghyirkyvpelskypagciy
epwkaslvdqraygcvlgtdyphrivkhevvhkenikrmgaaykvnrevr

SCOPe Domain Coordinates for d3cvva2:

Click to download the PDB-style file with coordinates for d3cvva2.
(The format of our PDB-style files is described here.)

Timeline for d3cvva2: