![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species) |
![]() | Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (32 PDB entries) probably orthologous to the human HLA-DQ group |
![]() | Domain d3cupa2: 3cup A:84-178 [245562] Other proteins in same PDB: d3cupa1, d3cupa3 automated match to d1muja1 complexed with epe, nag |
PDB Entry: 3cup (more details), 3.09 Å
SCOPe Domain Sequences for d3cupa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cupa2 b.1.1.2 (A:84-178) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} neapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrdh sfhklsyltfipsdddiydckvehwgleepvlkhw
Timeline for d3cupa2: