Lineage for d3cupa2 (3cup A:84-178)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747348Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)
  7. 2747416Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (32 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 2747440Domain d3cupa2: 3cup A:84-178 [245562]
    Other proteins in same PDB: d3cupa1, d3cupa3
    automated match to d1muja1
    complexed with epe, nag

Details for d3cupa2

PDB Entry: 3cup (more details), 3.09 Å

PDB Description: crystal structure of the mhc class ii molecule i-ag7 in complex with the peptide gad221-235
PDB Compounds: (A:) H-2 class II histocompatibility antigen, A-D alpha chain

SCOPe Domain Sequences for d3cupa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cupa2 b.1.1.2 (A:84-178) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
neapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrdh
sfhklsyltfipsdddiydckvehwgleepvlkhw

SCOPe Domain Coordinates for d3cupa2:

Click to download the PDB-style file with coordinates for d3cupa2.
(The format of our PDB-style files is described here.)

Timeline for d3cupa2: