Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Mouse (Mus musculus), I-AB [TaxId:10090] [88815] (4 PDB entries) |
Domain d3cupa1: 3cup A:1A-83 [245561] Other proteins in same PDB: d3cupa2, d3cupa3 automated match to d1muja2 complexed with epe, nag fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 3cup (more details), 3.09 Å
SCOPe Domain Sequences for d3cupa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cupa1 d.19.1.1 (A:1A-83) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AB [TaxId: 10090]} ieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqgg lqniaaekhnlgiltkrsnftpat
Timeline for d3cupa1: