Lineage for d3cupa1 (3cup A:1A-83)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938226Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2938303Species Mouse (Mus musculus), I-AB [TaxId:10090] [88815] (4 PDB entries)
  8. 2938309Domain d3cupa1: 3cup A:1A-83 [245561]
    Other proteins in same PDB: d3cupa2, d3cupa3
    automated match to d1muja2
    complexed with epe, nag

    fragment; missing more than one-third of the common structure and/or sequence

Details for d3cupa1

PDB Entry: 3cup (more details), 3.09 Å

PDB Description: crystal structure of the mhc class ii molecule i-ag7 in complex with the peptide gad221-235
PDB Compounds: (A:) H-2 class II histocompatibility antigen, A-D alpha chain

SCOPe Domain Sequences for d3cupa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cupa1 d.19.1.1 (A:1A-83) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AB [TaxId: 10090]}
ieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqgg
lqniaaekhnlgiltkrsnftpat

SCOPe Domain Coordinates for d3cupa1:

Click to download the PDB-style file with coordinates for d3cupa1.
(The format of our PDB-style files is described here.)

Timeline for d3cupa1: