Lineage for d1aojb_ (1aoj B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13067Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 13068Family b.34.2.1: SH3-domain [50045] (16 protein domains)
  6. 13129Protein EPS8 SH3 domain [50082] (1 species)
  7. 13130Species Mouse (Mus musculus) [TaxId:10090] [50083] (1 PDB entry)
  8. 13132Domain d1aojb_: 1aoj B: [24556]

Details for d1aojb_

PDB Entry: 1aoj (more details), 2.5 Å

PDB Description: the sh3 domain of eps8 exists as a novel intertwined dimer

SCOP Domain Sequences for d1aojb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aojb_ b.34.2.1 (B:) EPS8 SH3 domain {Mouse (Mus musculus)}
kkyakskydfvarnsselsvmkddvleilddrrqwwkvrnasgdsgfvpnnildimrtpe

SCOP Domain Coordinates for d1aojb_:

Click to download the PDB-style file with coordinates for d1aojb_.
(The format of our PDB-style files is described here.)

Timeline for d1aojb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aoja_