SCOPe 2.07: Domain d3cu7b9: 3cu7 B:607-673

Lineage for d3cu7b9 (3cu7 B:607-673)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.94: Complement C3 linker domain-like [254109] (1 superfamily)

4. Superfamily g.94.1: Complement C3 linker domain-like [254128] (1 family)

5. Family g.94.1.1: Complement C3 linker domain-like [254162] (2 proteins)

6. Protein Complement C5 linker domain [254365] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [254798] (1 PDB entry)

8. Domain d3cu7b9: 3cu7 B:607-673 [245555]
   Other proteins in same PDB: d3cu7a1, d3cu7a2, d3cu7a3, d3cu7a4, d3cu7a5, d3cu7a6, d3cu7a7, d3cu7a8, d3cu7aa, d3cu7ab, d3cu7ac, d3cu7ad, d3cu7ae, d3cu7af, d3cu7b1, d3cu7b2, d3cu7b3, d3cu7b4, d3cu7b5, d3cu7b6, d3cu7b7, d3cu7b8, d3cu7ba, d3cu7bb, d3cu7bc, d3cu7bd, d3cu7be
   complexed with cd, nag

Details for d3cu7b9

PDB Entry: 3cu7, 3.11 Å

PDB Description: human complement component 5

PDB Compounds: (B:) Complement C5

SCOPe Domain Sequences for d3cu7b9:

Sequence; same for both SEQRES and ATOM records:

>d3cu7b9 g.94.1.1 (B:607-673) Complement C5 linker domain {Human (Homo sapiens) [TaxId: 9606]}
savygvqrgakkplervfqfleksdlgcgaggglnnanvfhlagltfltnanaddsqend
epckeil

Timeline for d3cu7b9:

• d3cu7b9 first appeared in SCOPe 2.04
  
• d3cu7b9 appears in SCOPe 2.06
  
• d3cu7b9 appears in the current release, SCOPe 2.08