Lineage for d1aoja_ (1aoj A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58264Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 58293Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 58294Family b.34.2.1: SH3-domain [50045] (18 proteins)
  6. 58355Protein EPS8 SH3 domain [50082] (1 species)
  7. 58356Species Mouse (Mus musculus) [TaxId:10090] [50083] (3 PDB entries)
  8. 58361Domain d1aoja_: 1aoj A: [24555]

Details for d1aoja_

PDB Entry: 1aoj (more details), 2.5 Å

PDB Description: the sh3 domain of eps8 exists as a novel intertwined dimer

SCOP Domain Sequences for d1aoja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aoja_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus)}
kkyakskydfvarnsselsvmkddvleilddrrqwwkvrnasgdsgfvpnnildimrtpe

SCOP Domain Coordinates for d1aoja_:

Click to download the PDB-style file with coordinates for d1aoja_.
(The format of our PDB-style files is described here.)

Timeline for d1aoja_:

58361
d1aoja_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1aojb_