SCOPe 2.08: Domain d1aoja_: 1aoj A:

Lineage for d1aoja_ (1aoj A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein EPS8 SH3 domain [50082] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50083] (3 PDB entries)

8. Domain d1aoja_: 1aoj A: [24555]
   segment-swapped dimer

Details for d1aoja_

PDB Entry: 1aoj, 2.5 Å

PDB Description: the sh3 domain of eps8 exists as a novel intertwined dimer

PDB Compounds: (A:) eps8

SCOPe Domain Sequences for d1aoja_:

Sequence; same for both SEQRES and ATOM records:

>d1aoja_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}
kkyakskydfvarnsselsvmkddvleilddrrqwwkvrnasgdsgfvpnnildimrtpe

Timeline for d1aoja_:

• d1aoja_ first appeared (with stable ids) in SCOP 1.55
  
• d1aoja_ appears in SCOPe 2.07