Lineage for d1bb9__ (1bb9 -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58264Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 58293Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 58294Family b.34.2.1: SH3-domain [50045] (18 proteins)
  6. 58321Protein Amphiphysin 2 [50080] (1 species)
  7. 58322Species Rat (Rattus norvegicus) [TaxId:10116] [50081] (1 PDB entry)
  8. 58323Domain d1bb9__: 1bb9 - [24554]

Details for d1bb9__

PDB Entry: 1bb9 (more details), 2.2 Å

PDB Description: crystal structure of the sh3 domain from rat amphiphysin 2

SCOP Domain Sequences for d1bb9__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bb9__ b.34.2.1 (-) Amphiphysin 2 {Rat (Rattus norvegicus)}
ttgrldlppgfmfkvqaqhdytatdtdelqlkagdvvlvipfqnpeeqdegwlmgvkesd
wnqhkelekcrgvfpenftervq

SCOP Domain Coordinates for d1bb9__:

Click to download the PDB-style file with coordinates for d1bb9__.
(The format of our PDB-style files is described here.)

Timeline for d1bb9__: