SCOPe 2.08: Domain d1bb9a_: 1bb9 A:

Lineage for d1bb9a_ (1bb9 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Amphiphysin 2 [50080] (1 species)
   synonyms: Myc box dependent interacting protein 1, bin1

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50081] (4 PDB entries)

8. Domain d1bb9a_: 1bb9 A: [24554]

Details for d1bb9a_

PDB Entry: 1bb9, 2.2 Å

PDB Description: crystal structure of the sh3 domain from rat amphiphysin 2

PDB Compounds: (A:) amphiphysin 2

SCOPe Domain Sequences for d1bb9a_:

Sequence; same for both SEQRES and ATOM records:

>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ttgrldlppgfmfkvqaqhdytatdtdelqlkagdvvlvipfqnpeeqdegwlmgvkesd
wnqhkelekcrgvfpenftervq

Timeline for d1bb9a_:

• d1bb9a_ first appeared (with stable ids) in SCOP 1.55, called d1bb9__
  
• d1bb9a_ appears in SCOPe 2.07