| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein Amphiphysin 2 [50080] (1 species) synonyms: Myc box dependent interacting protein 1, bin1 |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [50081] (4 PDB entries) |
| Domain d1bb9a_: 1bb9 A: [24554] |
PDB Entry: 1bb9 (more details), 2.2 Å
SCOPe Domain Sequences for d1bb9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ttgrldlppgfmfkvqaqhdytatdtdelqlkagdvvlvipfqnpeeqdegwlmgvkesd
wnqhkelekcrgvfpenftervq
Timeline for d1bb9a_: