| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.29: Macroglobulin [254121] (8 families) ![]() C3 MG domains possibly arose by gene duplication according to PubMed 16177781; PubMed 17608619; possibly related to immunoglobulins according to Pfam clan annotations |
| Family b.1.29.3: Complement C3 MG2-like [254156] (3 proteins) Pfam PF01835 |
| Protein Complement C5 MG2 [254350] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [254783] (1 PDB entry) |
| Domain d3cu7a2: 3cu7 A:121-222 [245533] Other proteins in same PDB: d3cu7a1, d3cu7a3, d3cu7a4, d3cu7a5, d3cu7a6, d3cu7a7, d3cu7a8, d3cu7a9, d3cu7aa, d3cu7ab, d3cu7ac, d3cu7ad, d3cu7ae, d3cu7af, d3cu7b1, d3cu7b3, d3cu7b4, d3cu7b5, d3cu7b6, d3cu7b7, d3cu7b8, d3cu7b9, d3cu7ba, d3cu7bb, d3cu7bc, d3cu7bd, d3cu7be complexed with cd, nag |
PDB Entry: 3cu7 (more details), 3.11 Å
SCOPe Domain Sequences for d3cu7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cu7a2 b.1.29.3 (A:121-222) Complement C5 MG2 {Human (Homo sapiens) [TaxId: 9606]}
ydngflfihtdkpvytpdqsvkvrvyslnddlkpakretvltfidpegsevdmveeidhi
giisfpdfkipsnprygmwtikakykedfsttgtayfevkey
Timeline for d3cu7a2: