Lineage for d3ctpb_ (3ctp B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624506Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1624507Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1624744Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 1624745Protein automated matches [190646] (49 species)
    not a true protein
  7. 1624760Species Alkaliphilus metalliredigens [TaxId:293826] [255780] (1 PDB entry)
  8. 1624762Domain d3ctpb_: 3ctp B: [245531]
    automated match to d3kkeb_
    protein/DNA complex; complexed with na, xlf

Details for d3ctpb_

PDB Entry: 3ctp (more details), 1.41 Å

PDB Description: crystal structure of periplasmic binding protein/laci transcriptional regulator from alkaliphilus metalliredigens qymf complexed with d- xylulofuranose
PDB Compounds: (B:) Periplasmic binding protein/LacI transcriptional regulator

SCOPe Domain Sequences for d3ctpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ctpb_ c.93.1.0 (B:) automated matches {Alkaliphilus metalliredigens [TaxId: 293826]}
sktiglmvpnisnpffnqmasvieeyaknkgytlflcntdddkekektylevlqshrvag
iiasrsqcedeyanidipvvafenhildniitissdnynggrmafdhlyekgcrkilhik
gpevfeatelrykgfldgarakdleidfiefqhdfqvkmleedinsmkdivnydgifvfn
diaaatvmralkkrgvsipqevqiigfdnsfigellypslttinqpiealaytiiellik
iingegvliedyimevklierettis

SCOPe Domain Coordinates for d3ctpb_:

Click to download the PDB-style file with coordinates for d3ctpb_.
(The format of our PDB-style files is described here.)

Timeline for d3ctpb_: