SCOP 1.69: Domain d1ycsb2: 1ycs B:457-519

Lineage for d1ycsb2 (1ycs B:457-519)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.34: SH3-like barrel [50036] (15 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (35 proteins)

6. Protein 53BP2 [50078] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50079] (1 PDB entry)

8. Domain d1ycsb2: 1ycs B:457-519 [24553]
   Other proteins in same PDB: d1ycsa_, d1ycsb1

Details for d1ycsb2

PDB Entry: 1ycs, 2.2 Å

PDB Description: p53-53bp2 complex

SCOP Domain Sequences for d1ycsb2:

Sequence; same for both SEQRES and ATOM records:

>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens)}
imnkgviyalwdyepqnddelpmkegdcmtiihrededeiewwwarlndkegyvprnllg
lyp

Timeline for d1ycsb2:

• d1ycsb2 first appeared (with stable ids) in SCOP 1.55
  
• d1ycsb2 appears in SCOP 1.67
  
• d1ycsb2 appears in SCOP 1.71
  
• d1ycsb2 appears in the current release, SCOPe 2.08