Class b: All beta proteins [48724] (144 folds) |
Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) |
Family b.34.2.1: SH3-domain [50045] (35 proteins) |
Protein 53BP2 [50078] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50079] (1 PDB entry) |
Domain d1ycsb2: 1ycs B:457-519 [24553] Other proteins in same PDB: d1ycsa_, d1ycsb1 |
PDB Entry: 1ycs (more details), 2.2 Å
SCOP Domain Sequences for d1ycsb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens)} imnkgviyalwdyepqnddelpmkegdcmtiihrededeiewwwarlndkegyvprnllg lyp
Timeline for d1ycsb2: