Lineage for d1ycsb2 (1ycs B:457-519)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.34: SH3-like barrel [50036] (9 superfamilies) 
Superfamily b.34.2: SH3-domain [50044] (1 family) 
Family b.34.2.1: SH3-domain [50045] (18 proteins) 
Protein 53BP2 [50078] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50079] (1 PDB entry) 
Domain d1ycsb2: 1ycs B:457-519 [24553]
Other proteins in same PDB: d1ycsa_, d1ycsb1
Details for d1ycsb2
PDB Entry: 1ycs (more details), 2.2 Å
PDB Description: p53-53bp2 complex
SCOP Domain Sequences for d1ycsb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens)}
imnkgviyalwdyepqnddelpmkegdcmtiihrededeiewwwarlndkegyvprnllg
lyp
SCOP Domain Coordinates for d1ycsb2:
Click to download the PDB-style file with coordinates for d1ycsb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ycsb2:
View in 3D
