SCOPe 2.04: Domain d3csnd_: 3csn D:

Lineage for d3csnd_ (3csn D:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily)
   beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432

4. Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (2 families)

5. Family d.35.1.0: automated matches [196913] (1 protein)
   not a true family

6. Protein automated matches [196914] (2 species)
   not a true protein

7. Species Serratia marcescens [TaxId:615] [255779] (1 PDB entry)

8. Domain d3csnd_: 3csn D: [245529]
   automated match to d4jera_
   complexed with gol

Details for d3csnd_

PDB Entry: 3csn, 3 Å

PDB Description: structure of the serratia marcescens hemophore receptor hasr in complex with its hemophore hasa

PDB Compounds: (D:) hemophore hasa

SCOPe Domain Sequences for d3csnd_:

Sequence, based on SEQRES records:

>d3csnd_ d.35.1.0 (D:) automated matches {Serratia marcescens [TaxId: 615]}
pafsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaisst
anqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnl
sslqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaat

Sequence, based on observed residues (ATOM records):

>d3csnd_ d.35.1.0 (D:) automated matches {Serratia marcescens [TaxId: 615]}
pafsvnydssfggysihdylgqwastfgdansggfyggslsgsqyaisstanqvtafvag
gnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnlsslqaqghdg
vvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaat

Timeline for d3csnd_:

• d3csnd_ is new in SCOPe 2.04-stable
  
• d3csnd_ appears in SCOPe 2.05
  
• d3csnd_ appears in the current release, SCOPe 2.08, called d3csnd1