Lineage for d3csnc_ (3csn C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1645743Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily)
    beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432
  4. 1645744Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (2 families) (S)
  5. 1645762Family d.35.1.0: automated matches [196913] (1 protein)
    not a true family
  6. 1645763Protein automated matches [196914] (2 species)
    not a true protein
  7. 1645764Species Serratia marcescens [TaxId:615] [255779] (1 PDB entry)
  8. 1645765Domain d3csnc_: 3csn C: [245528]
    automated match to d4jera_
    complexed with gol

Details for d3csnc_

PDB Entry: 3csn (more details), 3 Å

PDB Description: structure of the serratia marcescens hemophore receptor hasr in complex with its hemophore hasa
PDB Compounds: (C:) hemophore hasa

SCOPe Domain Sequences for d3csnc_:

Sequence, based on SEQRES records: (download)

>d3csnc_ d.35.1.0 (C:) automated matches {Serratia marcescens [TaxId: 615]}
pafsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaisst
anqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnl
sslqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaat

Sequence, based on observed residues (ATOM records): (download)

>d3csnc_ d.35.1.0 (C:) automated matches {Serratia marcescens [TaxId: 615]}
pafsvnydssfggysihdylgqwastfgdansggfyggslsgsqyaisstanqvtafvag
gnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnlsslqaqghdg
vvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaat

SCOPe Domain Coordinates for d3csnc_:

Click to download the PDB-style file with coordinates for d3csnc_.
(The format of our PDB-style files is described here.)

Timeline for d3csnc_: