SCOPe 2.04: Domain d3cqoc1: 3cqo C:1-150

Lineage for d3cqoc1 (3cqo C:1-150)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (24 species)
   not a true protein

7. Species Morone saxatilis [TaxId:34816] [255778] (1 PDB entry)

8. Domain d3cqoc1: 3cqo C:1-150 [245522]
   automated match to d3le0a_
   complexed with ca, cl, fuc

Details for d3cqoc1

PDB Entry: 3cqo, 2.32 Å

PDB Description: crystal structure of a f-lectin (fucolectin) from morone saxatilis (striped bass) serum

PDB Compounds: (C:) fbp32

SCOPe Domain Sequences for d3cqoc1:

Sequence; same for both SEQRES and ATOM records:

>d3cqoc1 b.18.1.0 (C:1-150) automated matches {Morone saxatilis [TaxId: 34816]}
ynyknvalrgkatqsarylhthgaaynaidgnrnsdfeagscthtveqtnpwwrvdllep
yivtsititnrgdccperlngveihignslqengvanprvgvishipagishtisfterv
egryvtvllpgtnkvltlcevevhgyrapt

Timeline for d3cqoc1:

• d3cqoc1 is new in SCOPe 2.04-stable
  
• d3cqoc1 appears in SCOPe 2.05
  
• d3cqoc1 appears in the current release, SCOPe 2.08