Lineage for d3cqoc1 (3cqo C:1-150)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775328Species Morone saxatilis [TaxId:34816] [255778] (1 PDB entry)
  8. 2775333Domain d3cqoc1: 3cqo C:1-150 [245522]
    automated match to d3le0a_
    complexed with ca, cl, fuc

Details for d3cqoc1

PDB Entry: 3cqo (more details), 2.32 Å

PDB Description: crystal structure of a f-lectin (fucolectin) from morone saxatilis (striped bass) serum
PDB Compounds: (C:) fbp32

SCOPe Domain Sequences for d3cqoc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cqoc1 b.18.1.0 (C:1-150) automated matches {Morone saxatilis [TaxId: 34816]}
ynyknvalrgkatqsarylhthgaaynaidgnrnsdfeagscthtveqtnpwwrvdllep
yivtsititnrgdccperlngveihignslqengvanprvgvishipagishtisfterv
egryvtvllpgtnkvltlcevevhgyrapt

SCOPe Domain Coordinates for d3cqoc1:

Click to download the PDB-style file with coordinates for d3cqoc1.
(The format of our PDB-style files is described here.)

Timeline for d3cqoc1: