Lineage for d3cqob2 (3cqo B:151-293)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2369590Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2369591Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2370433Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2370434Protein automated matches [190770] (38 species)
    not a true protein
  7. 2370711Species Morone saxatilis [TaxId:34816] [255778] (1 PDB entry)
  8. 2370715Domain d3cqob2: 3cqo B:151-293 [245521]
    automated match to d3le0a_
    complexed with ca, cl, fuc

Details for d3cqob2

PDB Entry: 3cqo (more details), 2.32 Å

PDB Description: Crystal structure of a f-lectin (fucolectin) from morone saxatilis (striped bass) serum
PDB Compounds: (B:) fbp32

SCOPe Domain Sequences for d3cqob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cqob2 b.18.1.0 (B:151-293) automated matches {Morone saxatilis [TaxId: 34816]}
genlalkgkatqsslfesgiaynaidgnqannwemascthtkntmdpwwrmdlsqthrvf
svkvtnrdsfekringaeirigdsldnngnhnprcavitsipagastefqcngmdgryvn
ivipgreeyltlcevevygsvld

SCOPe Domain Coordinates for d3cqob2:

Click to download the PDB-style file with coordinates for d3cqob2.
(The format of our PDB-style files is described here.)

Timeline for d3cqob2: