SCOP 1.63: Domain d1lcka1: 1lck A:63-116

Lineage for d1lcka1 (1lck A:63-116)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.34: SH3-like barrel [50036] (12 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (24 proteins)

6. Protein p56-lck tyrosine kinase, SH3 domain [50076] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50077] (3 PDB entries)

8. Domain d1lcka1: 1lck A:63-116 [24552]
   Other proteins in same PDB: d1lcka2
   complexed with phs; mutant

Details for d1lcka1

PDB Entry: 1lck, 2.5 Å

PDB Description: sh3-sh2 domain fragment of human p56-lck tyrosine kinase complexed with the 10 residue synthetic phosphotyrosyl peptide tegqpyqpqpa

SCOP Domain Sequences for d1lcka1:

Sequence; same for both SEQRES and ATOM records:

>d1lcka1 b.34.2.1 (A:63-116) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens)}
dnlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfv

Timeline for d1lcka1:

• d1lcka1 first appeared (with stable ids) in SCOP 1.55
  
• d1lcka1 appears in SCOP 1.61
  
• d1lcka1 appears in SCOP 1.65
  
• d1lcka1 appears in the current release, SCOPe 2.08