Lineage for d1lcka1 (1lck A:63-116)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.34: SH3-like barrel [50036] (7 superfamilies) Superfamily b.34.2: SH3-domain [50044] (1 family) 
Family b.34.2.1: SH3-domain [50045] (16 proteins) 
Protein p56-lck tyrosine kinase, SH3 domain [50076] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50077] (1 PDB entry) 
Domain d1lcka1: 1lck A:63-116 [24552]
Other proteins in same PDB: d1lcka2
Details for d1lcka1
PDB Entry: 1lck (more details), 2.5 Å
PDB Description: sh3-sh2 domain fragment of human p56-lck tyrosine kinase complexed with the 10 residue synthetic phosphotyrosyl peptide tegqpyqpqpa
SCOP Domain Sequences for d1lcka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lcka1 b.34.2.1 (A:63-116) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens)}
dnlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfv
SCOP Domain Coordinates for d1lcka1:
Click to download the PDB-style file with coordinates for d1lcka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lcka1:
- d1lcka1 appears in SCOP 1.57
- d1lcka1 appears in the current release, SCOPe 2.08
View in 3D
