Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (31 species) not a true protein |
Species Morone saxatilis [TaxId:34816] [255778] (1 PDB entry) |
Domain d3cqoa2: 3cqo A:151-293 [245519] automated match to d3le0a_ complexed with ca, cl, fuc |
PDB Entry: 3cqo (more details), 2.32 Å
SCOPe Domain Sequences for d3cqoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cqoa2 b.18.1.0 (A:151-293) automated matches {Morone saxatilis [TaxId: 34816]} genlalkgkatqsslfesgiaynaidgnqannwemascthtkntmdpwwrmdlsqthrvf svkvtnrdsfekringaeirigdsldnngnhnprcavitsipagastefqcngmdgryvn ivipgreeyltlcevevygsvld
Timeline for d3cqoa2:
View in 3D Domains from other chains: (mouse over for more information) d3cqob1, d3cqob2, d3cqoc1, d3cqoc2 |