Lineage for d1hsq__ (1hsq -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13067Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 13068Family b.34.2.1: SH3-domain [50045] (16 proteins)
  6. 13197Protein Phospholipase C, SH3 domain [50074] (1 species)
  7. 13198Species Human (Homo sapiens) [TaxId:9606] [50075] (2 PDB entries)
  8. 13200Domain d1hsq__: 1hsq - [24551]

Details for d1hsq__

PDB Entry: 1hsq (more details)

PDB Description: solution structure of the sh3 domain of phospholipase cgamma

SCOP Domain Sequences for d1hsq__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hsq__ b.34.2.1 (-) Phospholipase C, SH3 domain {Human (Homo sapiens)}
gsptfkcavkalfdykaqredeltfiksaiiqnvekqeggwwrgdyggkkqlwfpsnyve
emvnpegihrd

SCOP Domain Coordinates for d1hsq__:

Click to download the PDB-style file with coordinates for d1hsq__.
(The format of our PDB-style files is described here.)

Timeline for d1hsq__: