Lineage for d1hsqa1 (1hsq A:3-64)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783203Protein Phospholipase C, SH3 domain [50074] (1 species)
  7. 2783204Species Human (Homo sapiens) [TaxId:9606] [50075] (2 PDB entries)
  8. 2783205Domain d1hsqa1: 1hsq A:3-64 [24551]
    Other proteins in same PDB: d1hsqa2, d1hsqa3

Details for d1hsqa1

PDB Entry: 1hsq (more details)

PDB Description: solution structure of the sh3 domain of phospholipase cgamma
PDB Compounds: (A:) phospholipase c-gamma (sh3 domain)

SCOPe Domain Sequences for d1hsqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hsqa1 b.34.2.1 (A:3-64) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
ptfkcavkalfdykaqredeltfiksaiiqnvekqeggwwrgdyggkkqlwfpsnyveem
vn

SCOPe Domain Coordinates for d1hsqa1:

Click to download the PDB-style file with coordinates for d1hsqa1.
(The format of our PDB-style files is described here.)

Timeline for d1hsqa1: