Lineage for d3cm7c_ (3cm7 C:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038051Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 3038052Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 3038053Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 3038108Protein BIR domains of XIAP [57928] (1 species)
  7. 3038109Species Human (Homo sapiens) [TaxId:9606] [57929] (15 PDB entries)
    Uniprot P98170 241-356
  8. 3038135Domain d3cm7c_: 3cm7 C: [245506]
    automated match to d1tfqa_
    complexed with x22, zn
    has additional insertions and/or extensions that are not grouped together

Details for d3cm7c_

PDB Entry: 3cm7 (more details), 3.1 Å

PDB Description: Crystal Structure of XIAP-BIR3 domain in complex with Smac-mimetic compuond, Smac005
PDB Compounds: (C:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d3cm7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cm7c_ g.52.1.1 (C:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
stnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkp
sedpweqhakwypgckylleqkgqeyinnihlthsleeclvr

SCOPe Domain Coordinates for d3cm7c_:

Click to download the PDB-style file with coordinates for d3cm7c_.
(The format of our PDB-style files is described here.)

Timeline for d3cm7c_: