![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) ![]() |
![]() | Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
![]() | Protein BIR domains of XIAP [57928] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57929] (15 PDB entries) Uniprot P98170 241-356 |
![]() | Domain d3cm7a_: 3cm7 A: [245504] automated match to d1tfqa_ complexed with x22, zn |
PDB Entry: 3cm7 (more details), 3.1 Å
SCOPe Domain Sequences for d3cm7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cm7a_ g.52.1.1 (A:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps edpweqhakwypgckylleqkgqeyinnihlthsleeclvr
Timeline for d3cm7a_: