Lineage for d3cm7a_ (3cm7 A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1707316Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 1707317Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 1707318Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 1707373Protein BIR domains of XIAP [57928] (1 species)
  7. 1707374Species Human (Homo sapiens) [TaxId:9606] [57929] (15 PDB entries)
    Uniprot P98170 241-356
  8. 1707402Domain d3cm7a_: 3cm7 A: [245504]
    automated match to d1tfqa_
    complexed with x22, zn

Details for d3cm7a_

PDB Entry: 3cm7 (more details), 3.1 Å

PDB Description: Crystal Structure of XIAP-BIR3 domain in complex with Smac-mimetic compuond, Smac005
PDB Compounds: (A:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d3cm7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cm7a_ g.52.1.1 (A:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps
edpweqhakwypgckylleqkgqeyinnihlthsleeclvr

SCOPe Domain Coordinates for d3cm7a_:

Click to download the PDB-style file with coordinates for d3cm7a_.
(The format of our PDB-style files is described here.)

Timeline for d3cm7a_: