Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (74 species) not a true protein |
Species Streptomyces coelicolor [TaxId:100226] [231096] (3 PDB entries) |
Domain d3ck5d2: 3ck5 D:130-360 [245502] Other proteins in same PDB: d3ck5a1, d3ck5a3, d3ck5b1, d3ck5b3, d3ck5c1, d3ck5c3, d3ck5d1, d3ck5d3 automated match to d3bjsa2 complexed with mg |
PDB Entry: 3ck5 (more details), 2.3 Å
SCOPe Domain Sequences for d3ck5d2:
Sequence, based on SEQRES records: (download)
>d3ck5d2 c.1.11.0 (D:130-360) automated matches {Streptomyces coelicolor [TaxId: 100226]} ydpvvpvyaggidlelpvadlktqadrflaggfraikmkvgrpdlkedvdrvsalrehlg dsfplmvdanmkwtvdgairaaralapfdlhwieeptipddlvgnarivresghtiagge nlhtlydfhnavragsltlpepdvsniggyttfrkvaalaeannmlltshgvhdltvhal asvphrtymeahgfglhaymaepmavtdgcvsapdrpghgvvldferlgrl
>d3ck5d2 c.1.11.0 (D:130-360) automated matches {Streptomyces coelicolor [TaxId: 100226]} ydpvvpvyaggidlelpvadlktqadrflaggfraikmkvgrpdlkedvdrvsalrehlg dsfplmvdanmkwtvdgairaaralapfdlhwieeptipddlvgnarivresghtiagge nlhtlydfhnavragsltlpepdvsniggyttfrkvaalaeannmlltshgvhdltvhal asvphrtymeahmavtdgcvsapdrpghgvvldferlgrl
Timeline for d3ck5d2: