| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein Phospholipase C, SH3 domain [50074] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [50075] (2 PDB entries) |
| Domain d2hspa1: 2hsp A:3-64 [24550] Other proteins in same PDB: d2hspa2, d2hspa3 |
PDB Entry: 2hsp (more details)
SCOPe Domain Sequences for d2hspa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hspa1 b.34.2.1 (A:3-64) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
ptfkcavkalfdykaqredeltfiksaiiqnvekqeggwwrgdyggkkqlwfpsnyveem
vn
Timeline for d2hspa1: