SCOPe 2.08: Domain d2hspa1: 2hsp A:3-64

Lineage for d2hspa1 (2hsp A:3-64)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Phospholipase C, SH3 domain [50074] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50075] (2 PDB entries)

8. Domain d2hspa1: 2hsp A:3-64 [24550]
   Other proteins in same PDB: d2hspa2, d2hspa3

Details for d2hspa1

PDB Entry: 2hsp

PDB Description: solution structure of the sh3 domain of phospholipase cgamma

PDB Compounds: (A:) phospholipase c-gamma (sh3 domain)

SCOPe Domain Sequences for d2hspa1:

Sequence; same for both SEQRES and ATOM records:

>d2hspa1 b.34.2.1 (A:3-64) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
ptfkcavkalfdykaqredeltfiksaiiqnvekqeggwwrgdyggkkqlwfpsnyveem
vn

Timeline for d2hspa1:

• d2hspa1 first appeared (with stable ids) in SCOP 1.55, called d2hsp__
  
• d2hspa1 was called d2hspa_ in SCOPe 2.07