Lineage for d3ck5a1 (3ck5 A:4-129)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948596Species Streptomyces coelicolor [TaxId:100226] [231094] (3 PDB entries)
  8. 2948605Domain d3ck5a1: 3ck5 A:4-129 [245495]
    Other proteins in same PDB: d3ck5a2, d3ck5a3, d3ck5b2, d3ck5b3, d3ck5c2, d3ck5c3, d3ck5d2, d3ck5d3
    automated match to d3bjsa1
    complexed with mg

Details for d3ck5a1

PDB Entry: 3ck5 (more details), 2.3 Å

PDB Description: crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium
PDB Compounds: (A:) Putative racemase

SCOPe Domain Sequences for d3ck5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ck5a1 d.54.1.0 (A:4-129) automated matches {Streptomyces coelicolor [TaxId: 100226]}
iervrtdlyriplptrltdsthgammdfelitvriedsdgatglgytytvnhggaavatm
vdkdlrgcllgadaeqiekiwqsmwwrlhyagrgghatsaisavdialwdlkgirartpl
wklfgg

SCOPe Domain Coordinates for d3ck5a1:

Click to download the PDB-style file with coordinates for d3ck5a1.
(The format of our PDB-style files is described here.)

Timeline for d3ck5a1: