Lineage for d3cjaa2 (3cja A:179-461)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2122051Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2123164Family c.55.1.15: NTPDase (Nucleoside triphosphate diphosphohydrolase)-like [254154] (2 protein domains)
    Pfam PF01150; relationship to PPX/GPPA (c.55.1.8) discussed in PubMed 18458329
  6. 2123165Protein NTPDase2 [254346] (1 species)
  7. 2123166Species Norway rat (Rattus norvegicus) [TaxId:10116] [254779] (4 PDB entries)
  8. 2123174Domain d3cjaa2: 3cja A:179-461 [245494]
    automated match to d3cj7a2
    complexed with anp, ca

Details for d3cjaa2

PDB Entry: 3cja (more details), 2.1 Å

PDB Description: Structure of Rattus norvegicus NTPDase2 in complex with calcium and AMPPNP
PDB Compounds: (A:) Ectonucleoside triphosphate diphosphohydrolase 2

SCOPe Domain Sequences for d3cjaa2:

Sequence, based on SEQRES records: (download)

>d3cjaa2 c.55.1.15 (A:179-461) NTPDase2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nfikygwvgrwirprkgtlgamdlggastqitfettspsedpgnevhlrlygqhyrvyth
sflcygrdqillrllasalqihrfhpcwpkgystqvllqevyqspctmgqrprafngsai
vslsgtsnatlcrdlvsrlfnisscpfsqcsfngvfqppvagnfiafsafyytvdflttv
mglpvgtlkqleeateitcnqtwtelqarvpgqktrladycavamfihqllsrgyhfder
sfrevvfqkkaadtavgwalgymlnltnlipadlpglrkgthf

Sequence, based on observed residues (ATOM records): (download)

>d3cjaa2 c.55.1.15 (A:179-461) NTPDase2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nfikygwvgrwirprkgtlgamdlggastqitfettspsedpgnevhlrlygqhyrvyth
sflcygrdqillrllasalqihrfhpcwpkgystqvllqevyqspctmgqsaivslsgts
natlcrdlvsrlfnisscpfsqcsfngvfqppvagnfiafsafyytvdflttvmglpvgt
lkqleeateitcnqtwtelqarvpgqktrladycavamfihqllsrgyhfdersfrevvf
qkkaadtavgwalgymlnltnlipadlpglrkgthf

SCOPe Domain Coordinates for d3cjaa2:

Click to download the PDB-style file with coordinates for d3cjaa2.
(The format of our PDB-style files is described here.)

Timeline for d3cjaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cjaa1