Lineage for d3semb_ (3sem B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783045Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)
  7. 2783046Species Caenorhabditis elegans, SEM-5 [TaxId:6239] [50073] (5 PDB entries)
    Sex muscle abnormal protein 5
  8. 2783052Domain d3semb_: 3sem B: [24549]
    C-terminal domain

Details for d3semb_

PDB Entry: 3sem (more details), 2.2 Å

PDB Description: sem5 sh3 domain complexed with peptoid inhibitor
PDB Compounds: (B:) sex muscle abnormal protein 5

SCOPe Domain Sequences for d3semb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3semb_ b.34.2.1 (B:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]}
etkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvcpyn

SCOPe Domain Coordinates for d3semb_:

Click to download the PDB-style file with coordinates for d3semb_.
(The format of our PDB-style files is described here.)

Timeline for d3semb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3sema_