Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.15: NTPDase (Nucleoside triphosphate diphosphohydrolase)-like [254154] (2 proteins) Pfam PF01150; relationship to PPX/GPPA (c.55.1.8) discussed in PubMed 18458329 |
Protein NTPDase2 [254346] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [254779] (4 PDB entries) |
Domain d3cj1a1: 3cj1 A:36-178 [245487] automated match to d3cj7a1 |
PDB Entry: 3cj1 (more details), 1.7 Å
SCOPe Domain Sequences for d3cj1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cj1a1 c.55.1.15 (A:36-178) NTPDase2 {Norway rat (Rattus norvegicus) [TaxId: 10116]} palkygivldagsshtsmfvykwpadkendtgivgqhsscdvqgggissyandpskagqs lvrcleqalrdvprdrhastplylgatagmrllnltspeatarvleavtqtltqypfdfr garilsgqdegvfgwvtanylle
Timeline for d3cj1a1: