SCOPe 2.04: Domain d3cj1a1: 3cj1 A:36-178

Lineage for d3cj1a1 (3cj1 A:36-178)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.15: NTPDase (Nucleoside triphosphate diphosphohydrolase)-like [254154] (2 proteins)
   Pfam PF01150; relationship to PPX/GPPA (c.55.1.8) discussed in PubMed 18458329

6. Protein NTPDase2 [254346] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [254779] (4 PDB entries)

8. Domain d3cj1a1: 3cj1 A:36-178 [245487]
   automated match to d3cj7a1

Details for d3cj1a1

PDB Entry: 3cj1, 1.7 Å

PDB Description: Structure of Rattus norvegicus NTPDase2

PDB Compounds: (A:) Ectonucleoside triphosphate diphosphohydrolase 2

SCOPe Domain Sequences for d3cj1a1:

Sequence; same for both SEQRES and ATOM records:

>d3cj1a1 c.55.1.15 (A:36-178) NTPDase2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
palkygivldagsshtsmfvykwpadkendtgivgqhsscdvqgggissyandpskagqs
lvrcleqalrdvprdrhastplylgatagmrllnltspeatarvleavtqtltqypfdfr
garilsgqdegvfgwvtanylle

Timeline for d3cj1a1:

• d3cj1a1 is new in SCOPe 2.04-stable
  
• d3cj1a1 appears in SCOPe 2.05
  
• d3cj1a1 appears in the current release, SCOPe 2.08