SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3caej_ (3cae J:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121131Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2121132Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2121350Family c.52.1.17: Endonuclease I (Holliday junction resolvase) [53029] (2 protein domains)
    automatically mapped to Pfam PF05367
  6. 2121365Protein automated matches [254622] (2 species)
    not a true protein
  7. 2121366Species Bacteriophage T7 [TaxId:10760] [256395] (1 PDB entry)
  8. 2121376Domain d3caej_: 3cae J: [245486]
    automated match to d1m0da_

Details for d3caej_

PDB Entry: 3cae (more details), 3 Å

PDB Description: structure of nnqqny as an insert in t7 endonuclease i
PDB Compounds: (J:) Endodeoxyribonuclease 1

SCOPe Domain Sequences for d3caej_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3caej_ c.52.1.17 (J:) automated matches {Bacteriophage T7 [TaxId: 10760]}
mgledkvskqleskgikfeyeewkvpysnnqqnysshtytpdfllpngifvetkglwesd
drkkhllireqhpeldirivfsssrtklykgsptsygefcekhgikfadklipaewikep
kkevpfdrlkrk

SCOPe Domain Coordinates for d3caej_:

Click to download the PDB-style file with coordinates for d3caej_.
(The format of our PDB-style files is described here.)

Timeline for d3caej_: