Lineage for d3caeh_ (3cae H:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882485Family c.52.1.17: Endonuclease I (Holliday junction resolvase) [53029] (2 proteins)
    automatically mapped to Pfam PF05367
  6. 2882500Protein automated matches [254622] (2 species)
    not a true protein
  7. 2882501Species Bacteriophage T7 [TaxId:10760] [256395] (1 PDB entry)
  8. 2882509Domain d3caeh_: 3cae H: [245484]
    automated match to d1m0da_

Details for d3caeh_

PDB Entry: 3cae (more details), 3 Å

PDB Description: structure of nnqqny as an insert in t7 endonuclease i
PDB Compounds: (H:) endonuclease I

SCOPe Domain Sequences for d3caeh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3caeh_ c.52.1.17 (H:) automated matches {Bacteriophage T7 [TaxId: 10760]}
mgledkvskqleskgikfeyeewkvpysnnqqnysshtytpdfllpngifvetkglwesd
drkkhllireqhpeldirivfsssrtklykgsptsygefcekhgikfadklipaewikep
kkevpfdrlkrk

SCOPe Domain Coordinates for d3caeh_:

Click to download the PDB-style file with coordinates for d3caeh_.
(The format of our PDB-style files is described here.)

Timeline for d3caeh_: