Lineage for d3ca9b1 (3ca9 B:1-125)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818071Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2818270Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2818271Protein automated matches [191182] (20 species)
    not a true protein
  7. 2818449Species Paramecium bursaria chlorella virus il3a [TaxId:46019] [255769] (3 PDB entries)
  8. 2818455Domain d3ca9b1: 3ca9 B:1-125 [245476]
    Other proteins in same PDB: d3ca9a2, d3ca9b2
    automated match to d1sixa_
    complexed with dud, mg

Details for d3ca9b1

PDB Entry: 3ca9 (more details), 3 Å

PDB Description: Evolution of chlorella virus dUTPase
PDB Compounds: (B:) deoxyuridine triphosphatase

SCOPe Domain Sequences for d3ca9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ca9b1 b.85.4.0 (B:1-125) automated matches {Paramecium bursaria chlorella virus il3a [TaxId: 46019]}
mssllvkklvesattpmrgsegaagydissvedvvvpamgriavstgisirvpdgtygri
aprsglaykygidvlagvidedytgevkvilyntterdyiikkgdriaqlileqivtpgv
avvld

SCOPe Domain Coordinates for d3ca9b1:

Click to download the PDB-style file with coordinates for d3ca9b1.
(The format of our PDB-style files is described here.)

Timeline for d3ca9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ca9b2