SCOPe 2.08: Domain d3ca9a1: 3ca9 A:1-125

Lineage for d3ca9a1 (3ca9 A:1-125)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.0: automated matches [191644] (1 protein)
   not a true family

6. Protein automated matches [191182] (20 species)
   not a true protein

7. Species Paramecium bursaria chlorella virus il3a [TaxId:46019] [255769] (3 PDB entries)

8. Domain d3ca9a1: 3ca9 A:1-125 [245475]
   Other proteins in same PDB: d3ca9a2, d3ca9b2
   automated match to d1sixa_
   complexed with dud, mg

Details for d3ca9a1

PDB Entry: 3ca9, 3 Å

PDB Description: Evolution of chlorella virus dUTPase

PDB Compounds: (A:) deoxyuridine triphosphatase

SCOPe Domain Sequences for d3ca9a1:

Sequence; same for both SEQRES and ATOM records:

>d3ca9a1 b.85.4.0 (A:1-125) automated matches {Paramecium bursaria chlorella virus il3a [TaxId: 46019]}
mssllvkklvesattpmrgsegaagydissvedvvvpamgriavstgisirvpdgtygri
aprsglaykygidvlagvidedytgevkvilyntterdyiikkgdriaqlileqivtpgv
avvld

Timeline for d3ca9a1:

• d3ca9a1 first appeared in SCOPe 2.04, called d3ca9a_
  
• d3ca9a1 appears in SCOPe 2.07