Lineage for d3c84e1 (3c84 E:1-207)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408110Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2408111Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2408524Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2408525Protein automated matches [193506] (5 species)
    not a true protein
  7. 2408526Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (60 PDB entries)
  8. 2408566Domain d3c84e1: 3c84 E:1-207 [245474]
    Other proteins in same PDB: d3c84a2, d3c84b2, d3c84c2, d3c84d2, d3c84e2
    automated match to d2c9ta_
    complexed with ipa, mg, th4

Details for d3c84e1

PDB Entry: 3c84 (more details), 1.94 Å

PDB Description: Crystal structure of a complex of AChBP from aplysia californica and the neonicotinoid thiacloprid
PDB Compounds: (E:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d3c84e1:

Sequence, based on SEQRES records: (download)

>d3c84e1 b.96.1.0 (E:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrer

Sequence, based on observed residues (ATOM records): (download)

>d3c84e1 b.96.1.0 (E:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwklnsl
mwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrlsf
mcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqtrqv
qhysccpepyidvnlvvkfrer

SCOPe Domain Coordinates for d3c84e1:

Click to download the PDB-style file with coordinates for d3c84e1.
(The format of our PDB-style files is described here.)

Timeline for d3c84e1: