Lineage for d2semb_ (2sem B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13067Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 13068Family b.34.2.1: SH3-domain [50045] (16 proteins)
  6. 13145Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)
  7. 13146Species Caenorhabditis elegans, SEM-5 [TaxId:6239] [50073] (3 PDB entries)
  8. 13150Domain d2semb_: 2sem B: [24547]

Details for d2semb_

PDB Entry: 2sem (more details), 2.2 Å

PDB Description: sem5 sh3 domain complexed with peptoid inhibitor

SCOP Domain Sequences for d2semb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2semb_ b.34.2.1 (B:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5}
tkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvcpynsn

SCOP Domain Coordinates for d2semb_:

Click to download the PDB-style file with coordinates for d2semb_.
(The format of our PDB-style files is described here.)

Timeline for d2semb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2sema_