SCOPe 2.06: Domain d3c6qc_: 3c6q C:

Lineage for d3c6qc_ (3c6q C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (70 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [187722] (4 PDB entries)

8. Domain d3c6qc_: 3c6q C: [245463]
   automated match to d2fn8a_
   complexed with xyp

Details for d3c6qc_

PDB Entry: 3c6q, 2.3 Å

PDB Description: apo and ligand-bound form of a thermophilic glucose/xylose binding protein

PDB Compounds: (C:) Sugar ABC transporter, periplasmic sugar-binding protein

SCOPe Domain Sequences for d3c6qc_:

Sequence; same for both SEQRES and ATOM records:

>d3c6qc_ c.93.1.0 (C:) automated matches {Thermotoga maritima [TaxId: 243274]}
mltigvigksvhpywsqveqgvkaagkalgvdtkffvpqkcdinaqlqmlesfiaegvng
iaiapsdptaviptikkalemgipvvtldtdspdsgryvyigtdnyqagytaglimkell
ggkgkvvigtgsltamnslqriqgfkdaikdseieivdilndcedgaravslaeaalnah
pdldaffgvyayngpaqalvvknagkvgkvkivcfdttpdilqyvkegviqatmgqrpym
mgylsvtvlylmnkigvqntlmmlpkvkvdgkvdyvidtgvdvvtpenldeylkkmeelg
ipikf

Timeline for d3c6qc_:

• d3c6qc_ first appeared in SCOPe 2.04
  
• d3c6qc_ appears in SCOPe 2.05
  
• d3c6qc_ appears in SCOPe 2.07
  
• d3c6qc_ appears in the current release, SCOPe 2.08