SCOPe 2.07: Domain d3c6ea2: 3c6e A:298-394

Lineage for d3c6ea2 (3c6e A:298-394)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (72 species)
   not a true protein

7. Species Dengue virus 2 thailand/16681/84 [TaxId:31634] [231877] (2 PDB entries)

8. Domain d3c6ea2: 3c6e A:298-394 [245460]
   Other proteins in same PDB: d3c6ea1, d3c6ea3
   automated match to d3c5xa2
   protein/RNA complex; complexed with man, nag, ndg

Details for d3c6ea2

PDB Entry: 3c6e, 2.6 Å

PDB Description: crystal structure of the precursor membrane protein- envelope protein heterodimer from the dengue 2 virus at neutral ph

PDB Compounds: (A:) Envelope protein E

SCOPe Domain Sequences for d3c6ea2:

Sequence, based on SEQRES records:

>d3c6ea2 b.1.18.0 (A:298-394) automated matches {Dengue virus 2 thailand/16681/84 [TaxId: 31634]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk

Sequence, based on observed residues (ATOM records):

>d3c6ea2 b.1.18.0 (A:298-394) automated matches {Dengue virus 2 thailand/16681/84 [TaxId: 31634]}
sysmctgkfkvvkeiaetqhgtivirvqygdgspckipfeimdlekrhvlgrlitvnpiv
tekdspvnieaeppfgdsyiiigvepgqlklnwfkk

Timeline for d3c6ea2:

• d3c6ea2 first appeared in SCOPe 2.04
  
• d3c6ea2 appears in SCOPe 2.06
  
• d3c6ea2 appears in the current release, SCOPe 2.08