Lineage for d3c6ea2 (3c6e A:298-394)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766210Species Dengue virus 2 thailand/16681/84 [TaxId:31634] [231877] (2 PDB entries)
  8. 2766212Domain d3c6ea2: 3c6e A:298-394 [245460]
    Other proteins in same PDB: d3c6ea1, d3c6ea3
    automated match to d3c5xa2
    protein/RNA complex; complexed with nag, ndg

Details for d3c6ea2

PDB Entry: 3c6e (more details), 2.6 Å

PDB Description: crystal structure of the precursor membrane protein- envelope protein heterodimer from the dengue 2 virus at neutral ph
PDB Compounds: (A:) Envelope protein E

SCOPe Domain Sequences for d3c6ea2:

Sequence, based on SEQRES records: (download)

>d3c6ea2 b.1.18.0 (A:298-394) automated matches {Dengue virus 2 thailand/16681/84 [TaxId: 31634]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk

Sequence, based on observed residues (ATOM records): (download)

>d3c6ea2 b.1.18.0 (A:298-394) automated matches {Dengue virus 2 thailand/16681/84 [TaxId: 31634]}
sysmctgkfkvvkeiaetqhgtivirvqygdgspckipfeimdlekrhvlgrlitvnpiv
tekdspvnieaeppfgdsyiiigvepgqlklnwfkk

SCOPe Domain Coordinates for d3c6ea2:

Click to download the PDB-style file with coordinates for d3c6ea2.
(The format of our PDB-style files is described here.)

Timeline for d3c6ea2: