| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (81 species) not a true protein |
| Species Dengue virus 2 thailand/16681/84 [TaxId:31634] [231877] (2 PDB entries) |
| Domain d3c6ea2: 3c6e A:298-394 [245460] Other proteins in same PDB: d3c6ea1, d3c6ea3 automated match to d3c5xa2 protein/RNA complex; complexed with nag, ndg |
PDB Entry: 3c6e (more details), 2.6 Å
SCOPe Domain Sequences for d3c6ea2:
Sequence, based on SEQRES records: (download)
>d3c6ea2 b.1.18.0 (A:298-394) automated matches {Dengue virus 2 thailand/16681/84 [TaxId: 31634]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk
>d3c6ea2 b.1.18.0 (A:298-394) automated matches {Dengue virus 2 thailand/16681/84 [TaxId: 31634]}
sysmctgkfkvvkeiaetqhgtivirvqygdgspckipfeimdlekrhvlgrlitvnpiv
tekdspvnieaeppfgdsyiiigvepgqlklnwfkk
Timeline for d3c6ea2: