Lineage for d2sema_ (2sem A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2053715Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2053886Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)
  7. 2053887Species Caenorhabditis elegans, SEM-5 [TaxId:6239] [50073] (5 PDB entries)
    Sex muscle abnormal protein 5
  8. 2053890Domain d2sema_: 2sem A: [24546]
    C-terminal domain

Details for d2sema_

PDB Entry: 2sem (more details), 2.2 Å

PDB Description: sem5 sh3 domain complexed with peptoid inhibitor
PDB Compounds: (A:) protein (sex muscle abnormal protein 5)

SCOPe Domain Sequences for d2sema_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]}
etkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvcpyn

SCOPe Domain Coordinates for d2sema_:

Click to download the PDB-style file with coordinates for d2sema_.
(The format of our PDB-style files is described here.)

Timeline for d2sema_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2semb_