Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species) |
Species Caenorhabditis elegans, SEM-5 [TaxId:6239] [50073] (5 PDB entries) Sex muscle abnormal protein 5 |
Domain d2sema_: 2sem A: [24546] C-terminal domain |
PDB Entry: 2sem (more details), 2.2 Å
SCOPe Domain Sequences for d2sema_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} etkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvcpyn
Timeline for d2sema_: