![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
![]() | Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) ![]() |
![]() | Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins) |
![]() | Protein automated matches [226969] (5 species) not a true protein |
![]() | Species Dengue virus 2 thailand/16681/84 [TaxId:31634] [231875] (2 PDB entries) |
![]() | Domain d3c6ea1: 3c6e A:1-297 [245459] Other proteins in same PDB: d3c6ea2, d3c6ea3 automated match to d3c5xa1 protein/RNA complex; complexed with nag, ndg |
PDB Entry: 3c6e (more details), 2.6 Å
SCOPe Domain Sequences for d3c6ea1:
Sequence, based on SEQRES records: (download)
>d3c6ea1 f.10.1.1 (A:1-297) automated matches {Dengue virus 2 thailand/16681/84 [TaxId: 31634]} mrcigmsnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc ieakltntttesrcptqgepslneeqdkrfvckhsmvdrgwgngcglfgkggivtcamfr ckknmegkvvqpenleytivitphsgeehavgndtgkhgkeikitpqssiteaeltgygt vtmecsprtgldfnemvllqmenkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm
>d3c6ea1 f.10.1.1 (A:1-297) automated matches {Dengue virus 2 thailand/16681/84 [TaxId: 31634]} mrcigmsnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc ieakltntttesrcptqgepslneeqdkrfvckhsmvdrgwgngcglfgkggivtcamfr ckknmegkvvqpenleytivitphsgeehagkhgkeikitpqssiteaeltgygtvtmec sprtldfemvllqmenkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtfknphakk qdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm
Timeline for d3c6ea1: