SCOPe 2.05: Domain d3c3id_: 3c3i D:

Lineage for d3c3id_ (3c3i D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.0: automated matches [191644] (1 protein)
   not a true family

6. Protein automated matches [191182] (12 species)
   not a true protein

7. Species Paramecium bursaria chlorella virus il3a [TaxId:46019] [255769] (3 PDB entries)

8. Domain d3c3id_: 3c3i D: [245457]
   automated match to d3ehwa_
   complexed with dud, mg

Details for d3c3id_

PDB Entry: 3c3i, 3 Å

PDB Description: evolution of chlorella virus dutpase

PDB Compounds: (D:) deoxyuridine triphosphatase

SCOPe Domain Sequences for d3c3id_:

Sequence; same for both SEQRES and ATOM records:

>d3c3id_ b.85.4.0 (D:) automated matches {Paramecium bursaria chlorella virus il3a [TaxId: 46019]}
ssllvkklvesattpmrgsegaagydissvedvvvpamgriavstgisirvpdgtygria
prsglaykygidvlagvidsdyrgevkvilyntterdyiikkgdriaqlileqivtpgva
vvldlsdtar

Timeline for d3c3id_:

• d3c3id_ first appeared in SCOPe 2.04
  
• d3c3id_ appears in SCOPe 2.06
  
• d3c3id_ appears in the current release, SCOPe 2.08