Lineage for d3c3ed1 (3c3e D:1-303)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2530747Fold c.143: CofD-like [142337] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567; topological similarity to the CobT-like fold (52732)
  4. 2530748Superfamily c.143.1: CofD-like [142338] (2 families) (S)
  5. 2530749Family c.143.1.1: CofD-like [142339] (3 proteins)
    Pfam PF01933; UPF0052
  6. 2530756Protein LPPG:FO 2-phospho-L-lactate transferase CofD [142340] (1 species)
  7. 2530757Species Methanosarcina mazei [TaxId:2209] [142341] (3 PDB entries)
    Uniprot Q8PVT6 1-309
  8. 2530765Domain d3c3ed1: 3c3e D:1-303 [245453]
    Other proteins in same PDB: d3c3ea2, d3c3eb2, d3c3ec2, d3c3ed2
    automated match to d3c3da_
    complexed with fo1, gdp

Details for d3c3ed1

PDB Entry: 3c3e (more details), 3 Å

PDB Description: Crystal structure of 2-phospho-(S)-lactate transferase from Methanosarcina mazei in complex with Fo and GDP. Northeast Structural Genomics Consortium target MaR46
PDB Compounds: (D:) 2-phospho-L-lactate transferase

SCOPe Domain Sequences for d3c3ed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c3ed1 c.143.1.1 (D:1-303) LPPG:FO 2-phospho-L-lactate transferase CofD {Methanosarcina mazei [TaxId: 2209]}
miifsggtgtpklldglkeilpeeeltvvvntaedlwvsgnlispdldtvlylfsdqidr
krwwgiendtfgtyermkelgieeglklgdrdrathiirsniirdgasltdstvklsslf
gikanilpmsddpvstyietaegimhfqdfwigkrgepdvrgvdirgvseasispkvlea
fekeeniligpsnpitsigpiislpgmrellkkkkvvavspiignapvsgpagklmpacg
ievssmgvaeyyqdfldvfvfderdradefaferlgchasradtlmtstekskelaeivv
qaf

SCOPe Domain Coordinates for d3c3ed1:

Click to download the PDB-style file with coordinates for d3c3ed1.
(The format of our PDB-style files is described here.)

Timeline for d3c3ed1: